No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00027112-A01 |
Product name: | TMEM28 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant TMEM28. |
Gene id: | 27112 |
Gene name: | FAM155B |
Gene alias: | CXorf63|TED|TMEM28|bB57D9.1 |
Gene description: | family with sequence similarity 155, member B |
Genbank accession: | NM_015686 |
Immunogen: | TMEM28 (NP_056501, 245 a.a. ~ 341 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | NCIEAYQRLDRHAQEKYDEFDLVLHKYLQAEEYSIRSCTKGCKAVYKAWLCSEYFSVTQQECQRWVPCKQYCLEVQTRCPFILPDNEEMVYGGLPGF |
Protein accession: | NP_056501 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.78 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | TMEM28 polyclonal antibody (A01), Lot # 061025JCS1. Western Blot analysis of TMEM28 expression in Daoy. |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |