| Brand: | Abnova |
| Reference: | H00027111-M01A |
| Product name: | SDCBP2 monoclonal antibody (M01A), clone 3E8 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant SDCBP2. |
| Clone: | 3E8 |
| Isotype: | IgG2b Kappa |
| Gene id: | 27111 |
| Gene name: | SDCBP2 |
| Gene alias: | FLJ12256|SITAC18|ST-2 |
| Gene description: | syndecan binding protein (syntenin) 2 |
| Genbank accession: | BC002727 |
| Immunogen: | SDCBP2 (AAH02727, 1 a.a. ~ 292 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSSLYPSLEDLKVDQAIQAQVRASPKMPALPVQATAISPPPVLYPNLAELENYMGLSLSSQEVQESLLQIPEGDSTAVSGPGPGQMVAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQANTPASLVGLRFGDQLLQIDGRDCAGWSSHKAHQVVKKASGDKIVVVVRDRPFQRTVTMHKDSMGHVGFVIKKGKIVSLVKGSSAARNGLLTNHYVCEVDGQNVIGLKDKKIMEILATAGNVVTLTIIPSVIYEHMVKKLPPVLLHHTMDHSIPDA |
| Protein accession: | AAH02727 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (57.86 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |