| Brand:  | Abnova | 
| Reference:  | H00027111-M01 | 
| Product name:  | SDCBP2 monoclonal antibody (M01), clone 3E8 | 
| Product description:  | Mouse monoclonal antibody raised against a full length recombinant SDCBP2. | 
| Clone:  | 3E8 | 
| Isotype:  | IgG2b kappa | 
| Gene id:  | 27111 | 
| Gene name:  | SDCBP2 | 
| Gene alias:  | FLJ12256|SITAC18|ST-2 | 
| Gene description:  | syndecan binding protein (syntenin) 2 | 
| Genbank accession:  | BC002727 | 
| Immunogen:  | SDCBP2 (AAH02727, 1 a.a. ~ 292 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | MSSLYPSLEDLKVDQAIQAQVRASPKMPALPVQATAISPPPVLYPNLAELENYMGLSLSSQEVQESLLQIPEGDSTAVSGPGPGQMVAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQANTPASLVGLRFGDQLLQIDGRDCAGWSSHKAHQVVKKASGDKIVVVVRDRPFQRTVTMHKDSMGHVGFVIKKGKIVSLVKGSSAARNGLLTNHYVCEVDGQNVIGLKDKKIMEILATAGNVVTLTIIPSVIYEHMVKKLPPVLLHHTMDHSIPDA | 
| Protein accession:  | AAH02727 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (57.86 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  | http://www.abnova.com/application_image/ | 
| Application image note:  | Detection limit for recombinant GST tagged SDCBP2 is approximately 0.1ng/ml as a capture antibody. | 
| Applications:  | S-ELISA,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice |