No products
Prices are tax excluded
| Brand | Abnova | 
| Product type | Primary antibodies | 
| Reactivity | Human | 
| Host species | Mouse | 
| Applications | ELISA,WB-Re,WB-Tr | 
| Brand: | Abnova | 
| Reference: | H00027097-M01 | 
| Product name: | TAF5L monoclonal antibody (M01), clone 1C5 | 
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TAF5L. | 
| Clone: | 1C5 | 
| Isotype: | IgG2b Kappa | 
| Gene id: | 27097 | 
| Gene name: | TAF5L | 
| Gene alias: | PAF65B | 
| Gene description: | TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa | 
| Genbank accession: | NM_014409 | 
| Immunogen: | TAF5L (NP_055224, 1 a.a. ~ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence: | MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVE | 
| Protein accession: | NP_055224 | 
| Storage buffer: | In 1x PBS, pH 7.4 | 
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing: | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture: | ![]()  | 
| Quality control testing picture note: | Western Blot detection against Immunogen (38.61 KDa) . | 
| Product type: | Primary antibodies | 
| Host species: | Mouse | 
| Antigen species / target species: | Human | 
| Reactivity: | Human | 
| Application image: | ![]()  | 
| Application image note: | Western Blot analysis of TAF5L expression in transfected 293T cell line by TAF5L monoclonal antibody (M01), clone 1C5. Lane 1: TAF5L transfected lysate(36.99 KDa). Lane 2: Non-transfected lysate.  | 
| Applications: | ELISA,WB-Re,WB-Tr | 
| Shipping condition: | Dry Ice |