TAF5L polyclonal antibody (A01) View larger

TAF5L polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TAF5L polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about TAF5L polyclonal antibody (A01)

Brand: Abnova
Reference: H00027097-A01
Product name: TAF5L polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant TAF5L.
Gene id: 27097
Gene name: TAF5L
Gene alias: PAF65B
Gene description: TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa
Genbank accession: NM_014409
Immunogen: TAF5L (NP_055224, 1 a.a. ~ 117 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVE
Protein accession: NP_055224
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00027097-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.98 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027097-A01-1-34-1.jpg
Application image note: TAF5L polyclonal antibody (A01), Lot # 051018JC01 Western Blot analysis of TAF5L expression in SJCRH30 ( Cat # L027V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TAF5L polyclonal antibody (A01) now

Add to cart