Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of KCNMB3 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about KCNMB3 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00027094-A01 |
| Product name: | KCNMB3 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant KCNMB3. |
| Gene id: | 27094 |
| Gene name: | KCNMB3 |
| Gene alias: | KCNMB2|KCNMBL |
| Gene description: | potassium large conductance calcium-activated channel, subfamily M beta member 3 |
| Genbank accession: | NM_171828 |
| Immunogen: | KCNMB3 (NP_741979, 82 a.a. ~ 181 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | FMLSIQREESTCTAIHTDIMDDWLDCAFTCGVHCHGQGKYPCLQVFVNLSHPGQKALLHYNEEAVQINPKCFYTPKCHQDRNDLLNSALDIKEFFDHKNG |
| Protein accession: | NP_741979 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Differential distribution of Ca(2+)-activated potassium channel beta4 subunit in rat brain: Immunolocalization in neuronal mitochondria.Piwonska M, WilczekE, Szewczyk A, Wilczynski GM. Neuroscience. 2008 May 2;153(2):446-60. Epub 2008 Feb 8. |