| Brand: | Abnova |
| Reference: | H00027086-M01 |
| Product name: | FOXP1 monoclonal antibody (M01), clone 4E3-G11 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant FOXP1. |
| Clone: | 4E3-G11 |
| Isotype: | IgG2b |
| Gene id: | 27086 |
| Gene name: | FOXP1 |
| Gene alias: | 12CC4|FLJ23741|HSPC215|MGC12942|MGC88572|MGC99551|QRF1|hFKH1B |
| Gene description: | forkhead box P1 |
| Genbank accession: | BC005055 |
| Immunogen: | FOXP1 (AAH05055, 1 a.a. ~ 114 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQWHLINHQPSRSPSSWLKRLISSPWELEVLQVPLWGAVAETKMSGPVCQPNPSPF |
| Protein accession: | AAH05055 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.28 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged FOXP1 is 0.1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Characterization of human FOXP1 isoform 2, using monoclonal antibody 4E3-G11, and intron retention as a tissue-specific mechanism generating a novel FOXP1 isoform.Brown PJ, Kagaya R, Banham AH. Histopathology. 2008 Apr;52(5):632-7. Epub 2008 Feb 23. |