Cart 41 Product Products 15 437,40 € (empty)
No products
To be determined Shipping
15 437,40 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 41 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 15 437,40 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 15 437,40 €
Data sheet of STAU2 monoclonal antibody (M14), clone 3B7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,ELISA,WB-Re,WB-Tr |
More info about STAU2 monoclonal antibody (M14), clone 3B7
| Brand: | Abnova |
| Reference: | H00027067-M14 |
| Product name: | STAU2 monoclonal antibody (M14), clone 3B7 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant STAU2. |
| Clone: | 3B7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 27067 |
| Gene name: | STAU2 |
| Gene alias: | 39K2|39K3|DKFZp781K0371|MGC119606 |
| Gene description: | staufen, RNA binding protein, homolog 2 (Drosophila) |
| Genbank accession: | NM_014393 |
| Immunogen: | STAU2 (NP_055208, 341 a.a. ~ 440 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LGYKASTNLQDQLEKTGENKGWSGPKPGFPEPTNNTPKGILHLSPDVYQEMEASRHKVISGTTLGYLSPKDMNQPSSSFFSISPTSNSSATIARELLMNG |
| Protein accession: | NP_055208 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of STAU2 expression in transfected 293T cell line by STAU2 monoclonal antibody (M14), clone 3B7. Lane 1: STAU2 transfected lysate (Predicted MW: 52.8 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |