Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00027067-M14 |
Product name: | STAU2 monoclonal antibody (M14), clone 3B7 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant STAU2. |
Clone: | 3B7 |
Isotype: | IgG2a Kappa |
Gene id: | 27067 |
Gene name: | STAU2 |
Gene alias: | 39K2|39K3|DKFZp781K0371|MGC119606 |
Gene description: | staufen, RNA binding protein, homolog 2 (Drosophila) |
Genbank accession: | NM_014393 |
Immunogen: | STAU2 (NP_055208, 341 a.a. ~ 440 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LGYKASTNLQDQLEKTGENKGWSGPKPGFPEPTNNTPKGILHLSPDVYQEMEASRHKVISGTTLGYLSPKDMNQPSSSFFSISPTSNSSATIARELLMNG |
Protein accession: | NP_055208 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of STAU2 expression in transfected 293T cell line by STAU2 monoclonal antibody (M14), clone 3B7. Lane 1: STAU2 transfected lysate (Predicted MW: 52.8 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |