No products
Prices are tax excluded
| Brand | Abnova | 
| Product type | Primary antibodies | 
| Reactivity | Human | 
| Host species | Mouse | 
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re | 
| Brand: | Abnova | 
| Reference: | H00027067-M09 | 
| Product name: | STAU2 monoclonal antibody (M09), clone 3E9 | 
| Product description: | Mouse monoclonal antibody raised against a partial recombinant STAU2. | 
| Clone: | 3E9 | 
| Isotype: | IgG1 Kappa | 
| Gene id: | 27067 | 
| Gene name: | STAU2 | 
| Gene alias: | 39K2|39K3|DKFZp781K0371|MGC119606 | 
| Gene description: | staufen, RNA binding protein, homolog 2 (Drosophila) | 
| Genbank accession: | NM_014393 | 
| Immunogen: | STAU2 (NP_055208, 2 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence: | LQINQMFSVQLSLGEQTWESEGSSIKKAQQAVANKALTESTLPKPVQKPPKSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKPFP | 
| Protein accession: | NP_055208 | 
| Storage buffer: | In 1x PBS, pH 7.4 | 
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing: | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture: | ![]()  | 
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . | 
| Product type: | Primary antibodies | 
| Host species: | Mouse | 
| Antigen species / target species: | Human | 
| Reactivity: | Human | 
| Application image: | ![]()  | 
| Application image note: | STAU2 monoclonal antibody (M09), clone 3E9 Western Blot analysis of STAU2 expression in IMR-32 ( Cat # L008V1 ). | 
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re | 
| Shipping condition: | Dry Ice |