STAU2 monoclonal antibody (M04), clone 1B9 View larger

STAU2 monoclonal antibody (M04), clone 1B9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of STAU2 monoclonal antibody (M04), clone 1B9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about STAU2 monoclonal antibody (M04), clone 1B9

Brand: Abnova
Reference: H00027067-M04
Product name: STAU2 monoclonal antibody (M04), clone 1B9
Product description: Mouse monoclonal antibody raised against a partial recombinant STAU2.
Clone: 1B9
Isotype: IgG1 Kappa
Gene id: 27067
Gene name: STAU2
Gene alias: 39K2|39K3|DKFZp781K0371|MGC119606
Gene description: staufen, RNA binding protein, homolog 2 (Drosophila)
Genbank accession: NM_014393
Immunogen: STAU2 (NP_055208, 2 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LQINQMFSVQLSLGEQTWESEGSSIKKAQQAVANKALTESTLPKPVQKPPKSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKPFP
Protein accession: NP_055208
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00027067-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027067-M04-1-19-1.jpg
Application image note: STAU2 monoclonal antibody (M04), clone 1B9 Western Blot analysis of STAU2 expression in IMR-32 ( Cat # L008V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy STAU2 monoclonal antibody (M04), clone 1B9 now

Add to cart