Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of STAU2 monoclonal antibody (M01), clone 5C5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about STAU2 monoclonal antibody (M01), clone 5C5
| Brand: | Abnova |
| Reference: | H00027067-M01 |
| Product name: | STAU2 monoclonal antibody (M01), clone 5C5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant STAU2. |
| Clone: | 5C5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 27067 |
| Gene name: | STAU2 |
| Gene alias: | 39K2|39K3|DKFZp781K0371|MGC119606 |
| Gene description: | staufen, RNA binding protein, homolog 2 (Drosophila) |
| Genbank accession: | NM_014393 |
| Immunogen: | STAU2 (NP_055208, 2 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LQINQMFSVQLSLGEQTWESEGSSIKKAQQAVANKALTESTLPKPVQKPPKSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKPFP |
| Protein accession: | NP_055208 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | STAU2 monoclonal antibody (M01), clone 5C5 Western Blot analysis of STAU2 expression in IMR-32 ( Cat # L008V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |