No products
Prices are tax excluded
| Brand | Abnova | 
| Product type | Primary antibodies | 
| Reactivity | Human | 
| Host species | Mouse | 
| Applications | IF,ELISA | 
| Brand: | Abnova | 
| Reference: | H00027043-M06 | 
| Product name: | PELP1 monoclonal antibody (M06), clone 4F3 | 
| Product description: | Mouse monoclonal antibody raised against a full length recombinant PELP1. | 
| Clone: | 4F3 | 
| Isotype: | IgG2b Kappa | 
| Gene id: | 27043 | 
| Gene name: | PELP1 | 
| Gene alias: | HMX3|MNAR|P160 | 
| Gene description: | proline, glutamate and leucine rich protein 1 | 
| Genbank accession: | AY882602 | 
| Immunogen: | PELP1 (AAW80659.1, 337 a.a. ~ 410 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence: | LNSWSIGRDSLSPGQERPYSTVRTKVYAILELWVQVCGASAGMLQGGASGEALLTHLLSDISPPADALKLRSPR | 
| Protein accession: | AAW80659.1 | 
| Storage buffer: | In 1x PBS, pH 7.4 | 
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing: | Antibody Reactive Against Recombinant Protein. | 
| Product type: | Primary antibodies | 
| Host species: | Mouse | 
| Antigen species / target species: | Human | 
| Reactivity: | Human | 
| Application image: | ![]()  | 
| Application image note: | Immunofluorescence of monoclonal antibody to PELP1 on HeLa cell . [antibody concentration 10 ug/ml] | 
| Applications: | IF,ELISA | 
| Shipping condition: | Dry Ice |