Cart 4 Product Products 1 528,90 € (empty)
No products
To be determined Shipping
1 528,90 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 4 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 528,90 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 528,90 €
Data sheet of PELP1 monoclonal antibody (M03A), clone 2B6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about PELP1 monoclonal antibody (M03A), clone 2B6
| Brand: | Abnova |
| Reference: | H00027043-M03A |
| Product name: | PELP1 monoclonal antibody (M03A), clone 2B6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PELP1. |
| Clone: | 2B6 |
| Isotype: | IgM Kappa |
| Gene id: | 27043 |
| Gene name: | PELP1 |
| Gene alias: | HMX3|MNAR|P160 |
| Gene description: | proline, glutamate and leucine rich protein 1 |
| Genbank accession: | AY882602 |
| Immunogen: | PELP1 (AAW80659.1, 337 a.a. ~ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LNSWSIGRDSLSPGQERPYSTVRTKVYAILELWVQVCGASAGMLQGGASGEALLTHLLSDISPPADALKLRSPR |
| Protein accession: | AAW80659.1 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |