No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00027043-M01 |
Product name: | PELP1 monoclonal antibody (M01), clone 1F7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PELP1. |
Clone: | 1F7 |
Isotype: | IgG2b Kappa |
Gene id: | 27043 |
Gene name: | PELP1 |
Gene alias: | HMX3|MNAR|P160 |
Gene description: | proline, glutamate and leucine rich protein 1 |
Genbank accession: | AY882602 |
Immunogen: | PELP1 (AAW80659.1, 337 a.a. ~ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LNSWSIGRDSLSPGQERPYSTVRTKVYAILELWVQVCGASAGMLQGGASGEALLTHLLSDISPPADALKLRSPR |
Protein accession: | AAW80659.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged PELP1 is 0.1 ng/ml as a capture antibody. |
Applications: | WB-Ce,S-ELISA,ELISA |
Shipping condition: | Dry Ice |