Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Tr |
Brand: | Abnova |
Reference: | H00026999-M01 |
Product name: | CYFIP2 monoclonal antibody (M01), clone 4G6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CYFIP2. |
Clone: | 4G6 |
Isotype: | IgG2a Kappa |
Gene id: | 26999 |
Gene name: | CYFIP2 |
Gene alias: | PIR121 |
Gene description: | cytoplasmic FMR1 interacting protein 2 |
Genbank accession: | NM_014376 |
Immunogen: | CYFIP2 (NP_055191, 733 a.a. ~ 820 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | YGVIIPYPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLDQAISRFESEDLTSIVELEWLLEINRLTHRLLCKHMTLDSF |
Protein accession: | NP_055191 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CYFIP2 expression in transfected 293T cell line by CYFIP2 monoclonal antibody (M01), clone 4G6. Lane 1: CYFIP2 transfected lysate(145.7 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Tr |
Shipping condition: | Dry Ice |