Product successfully added to your shopping cart
Quantity
Total
There are 3 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 164,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 164,00 €
Data sheet of CYFIP2 monoclonal antibody (M01), clone 4G6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Tr |
More info about CYFIP2 monoclonal antibody (M01), clone 4G6
| Brand: | Abnova |
| Reference: | H00026999-M01 |
| Product name: | CYFIP2 monoclonal antibody (M01), clone 4G6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CYFIP2. |
| Clone: | 4G6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 26999 |
| Gene name: | CYFIP2 |
| Gene alias: | PIR121 |
| Gene description: | cytoplasmic FMR1 interacting protein 2 |
| Genbank accession: | NM_014376 |
| Immunogen: | CYFIP2 (NP_055191, 733 a.a. ~ 820 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | YGVIIPYPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLDQAISRFESEDLTSIVELEWLLEINRLTHRLLCKHMTLDSF |
| Protein accession: | NP_055191 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CYFIP2 expression in transfected 293T cell line by CYFIP2 monoclonal antibody (M01), clone 4G6. Lane 1: CYFIP2 transfected lysate(145.7 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Tr |
| Shipping condition: | Dry Ice |