| Brand: | Abnova |
| Reference: | H00026872-M01 |
| Product name: | STEAP1 monoclonal antibody (M01), clone 4F6-1F3 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant STEAP1. |
| Clone: | 4F6-1F3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 26872 |
| Gene name: | STEAP1 |
| Gene alias: | MGC19484|PRSS24|STEAP |
| Gene description: | six transmembrane epithelial antigen of the prostate 1 |
| Genbank accession: | BC011802 |
| Immunogen: | STEAP1 (AAH11802, 1 a.a. ~ 339 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL |
| Protein accession: | AAH11802 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (63.03 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | STEAP1 monoclonal antibody (M01), clone 4F6-1F3 Western Blot analysis of STEAP1 expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |