| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Tr |
| Brand: | Abnova |
| Reference: | H00026762-M02 |
| Product name: | HAVCR1 monoclonal antibody (M02), clone 2B9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HAVCR1. |
| Clone: | 2B9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 26762 |
| Gene name: | HAVCR1 |
| Gene alias: | HAVCR|HAVCR-1|KIM-1|KIM1|TIM-1|TIM1|TIMD1 |
| Gene description: | hepatitis A virus cellular receptor 1 |
| Genbank accession: | NM_012206 |
| Immunogen: | HAVCR1 (NP_036338, 23 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KVGGEAGPSVTLPCHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVTYRKDTRYKLLGDLSRRDVSLTIENTAVSDSGVYCCRVEHRGWFNDMKITVSL |
| Protein accession: | NP_036338 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of HAVCR1 expression in transfected 293T cell line by HAVCR1 monoclonal antibody (M02), clone 2B9. Lane 1: HAVCR1 transfected lysate(38.72 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Tr |
| Shipping condition: | Dry Ice |