| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00026580-A02 |
| Product name: | BSCL2 polyclonal antibody (A02) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant BSCL2. |
| Gene id: | 26580 |
| Gene name: | BSCL2 |
| Gene alias: | GNG3LG|HMN5|MGC4694|SPG17 |
| Gene description: | Bernardinelli-Seip congenital lipodystrophy 2 (seipin) |
| Genbank accession: | NM_032667 |
| Immunogen: | BSCL2 (NP_116056, 263 a.a. ~ 354 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | WPRHRFSLQVNIRKRDNSRKEVQRRISAHQPGPEGQEESTPQSDVTEDGESPEDPSGTEGQLSEEEKPDQQPLSGEEELEPEASDGSGSWED |
| Protein accession: | NP_116056 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.23 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of BSCL2 expression in transfected 293T cell line by BSCL2 polyclonal antibody (A02). Lane1:BSCL2 transfected lysate (Predicted MW: 44.5 KDa). Lane2:Non-transfected lysate. |
| Applications: | WB-Ce,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Adipose-specific knockout of Seipin/Bscl2 results in progressive lipodystrophy.Liu L, Jiang Q, Wang X, Zhang Y, Lin RC, Lam SM, Shui G, Zhou L, Li P, Wang Y, Cui X, Gao M, Zhang L, Lv Y, Xu G, Liu G, Zhao D, Yang H Diabetes. 2014 Mar 12. |