| Brand: | Abnova |
| Reference: | H00026574-M09 |
| Product name: | AATF monoclonal antibody (M09), clone 2H6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant AATF. |
| Clone: | 2H6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 26574 |
| Gene name: | AATF |
| Gene alias: | CHE-1|CHE1|DED |
| Gene description: | apoptosis antagonizing transcription factor |
| Genbank accession: | BC000591 |
| Immunogen: | AATF (AAH00591, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLT |
| Protein accession: | AAH00591 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | AATF monoclonal antibody (M09), clone 2H6 Western Blot analysis of AATF expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |