Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TIMM8B monoclonal antibody (M15), clone 8E5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about TIMM8B monoclonal antibody (M15), clone 8E5
| Brand: | Abnova |
| Reference: | H00026521-M15 |
| Product name: | TIMM8B monoclonal antibody (M15), clone 8E5 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant TIMM8B. |
| Clone: | 8E5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 26521 |
| Gene name: | TIMM8B |
| Gene alias: | DDP2|FLJ21744|MGC102866|MGC117373|TIM8B |
| Gene description: | translocase of inner mitochondrial membrane 8 homolog B (yeast) |
| Genbank accession: | NM_012459.1 |
| Immunogen: | TIMM8B (NP_036591.1, 1 a.a. ~ 83 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGGQ |
| Protein accession: | NP_036591.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.7 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of TIMM8B expression in transfected 293T cell line by TIMM8B monoclonal antibody (M15), clone 8E5. Lane 1: TIMM8B transfected lysate(9.3 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |