| Brand: | Abnova |
| Reference: | H00026520-M01 |
| Product name: | TIMM9 monoclonal antibody (M01), clone 1D6 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant TIMM9. |
| Clone: | 1D6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 26520 |
| Gene name: | TIMM9 |
| Gene alias: | TIM9|TIM9A |
| Gene description: | translocase of inner mitochondrial membrane 9 homolog (yeast) |
| Genbank accession: | BC020213 |
| Immunogen: | TIMM9 (AAH20213, 1 a.a. ~ 89 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR |
| Protein accession: | AAH20213 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to TIMM9 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | High expression of mitochondrial intermembrane chaperone TIMM9 represents a negative prognostic marker in gastric cancer.Lin CC, Fang CL, Sun DP, Hseu YC, Uen YH, Lin KY, Lin YC. J Formos Med Assoc. 2016 Oct 6. [Epub ahead of print] |