Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TIMM13 monoclonal antibody (M03A), clone 4F4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about TIMM13 monoclonal antibody (M03A), clone 4F4
| Brand: | Abnova |
| Reference: | H00026517-M03A |
| Product name: | TIMM13 monoclonal antibody (M03A), clone 4F4 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant TIMM13. |
| Clone: | 4F4 |
| Isotype: | IgM Kappa |
| Gene id: | 26517 |
| Gene name: | TIMM13 |
| Gene alias: | TIM13|TIM13B|TIMM13A|TIMM13B|ppv1 |
| Gene description: | translocase of inner mitochondrial membrane 13 homolog (yeast) |
| Genbank accession: | BC008607 |
| Immunogen: | TIMM13 (AAH08607, 1 a.a. ~ 95 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANM |
| Protein accession: | AAH08607 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.19 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Low-molecular-mass secretome profiling identifies C-C motif chemokine 5 as a potential plasma biomarker and therapeutic target for nasopharyngeal carcinoma.Lin SJ, Chang KP, Hsu CW, Chi LM, Chien KY, Liang Y, Tsai MH, Lin YT, Yu JS J Proteomics. 2013 Sep 27;94C:186-201. doi: 10.1016/j.jprot.2013.09.013. |