TIMM13 polyclonal antibody (A01) View larger

TIMM13 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TIMM13 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about TIMM13 polyclonal antibody (A01)

Brand: Abnova
Reference: H00026517-A01
Product name: TIMM13 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a full-length recombinant TIMM13.
Gene id: 26517
Gene name: TIMM13
Gene alias: TIM13|TIM13B|TIMM13A|TIMM13B|ppv1
Gene description: translocase of inner mitochondrial membrane 13 homolog (yeast)
Genbank accession: BC008607
Immunogen: TIMM13 (AAH08607, 1 a.a. ~ 95 a.a) full-length recombinant protein with GST tag.
Immunogen sequence/protein sequence: MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANM
Protein accession: AAH08607
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026517-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.56 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Nucleocytoplasmic human O-GlcNAc transferase is sufficient for O-GlcNAcylation of mitochondrial proteins.Trapannone R, Mariappa D, Ferenbach AT, van Aalten DM.
Biochem J. 2016 Apr 5;473(12):1693-702.

Reviews

Buy TIMM13 polyclonal antibody (A01) now

Add to cart