No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00026508-M14 |
| Product name: | HEYL monoclonal antibody (M14), clone 1C4 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant HEYL. |
| Clone: | 1C4 |
| Isotype: | IgG2b Kappa |
| Gene id: | 26508 |
| Gene name: | HEYL |
| Gene alias: | HRT3|MGC12623|bHLHb33 |
| Gene description: | hairy/enhancer-of-split related with YRPW motif-like |
| Genbank accession: | NM_014571 |
| Immunogen: | HEYL (NP_055386, 1 a.a. ~ 70 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKRRGIIEKRRRDRINSSLSELRRLV |
| Protein accession: | NP_055386 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.7 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | HEYL monoclonal antibody (M14), clone 1C4 Western Blot analysis of HEYL expression in HL-60 ( Cat # L014V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |