No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00026502-M03A |
Product name: | NARF monoclonal antibody (M03A), clone 7D9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NARF. |
Clone: | 7D9 |
Isotype: | IgM Kappa |
Gene id: | 26502 |
Gene name: | NARF |
Gene alias: | DKFZp434G0420|FLJ10067|IOP2 |
Gene description: | nuclear prelamin A recognition factor |
Genbank accession: | NM_031968 |
Immunogen: | NARF (NP_114174, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MKCEHCTRKECSKKTKTDDQENVSADAPSPAQENGEKGEFHKLADAKIFLSDCLACDSCMTAEEGVQLSQQNAKDFFRVLNLNKKCDTSKHKVLVVSVCP |
Protein accession: | NP_114174 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |