No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00026468-M05 |
Product name: | LHX6 monoclonal antibody (M05), clone 3E8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant LHX6. |
Clone: | 3E8 |
Isotype: | IgG2b Kappa |
Gene id: | 26468 |
Gene name: | LHX6 |
Gene alias: | LHX6.1|MGC119542|MGC119544|MGC119545 |
Gene description: | LIM homeobox 6 |
Genbank accession: | NM_014368 |
Immunogen: | LHX6 (NP_055183, 274 a.a. ~ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY |
Protein accession: | NP_055183 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![]() |
Application image note: | LHX6 monoclonal antibody (M05), clone 3E8 Western Blot analysis of LHX6 expression in HepG2 ( Cat # L019V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |