View larger

LHX6 polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of LHX6 polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00026468-A01
Product name:	LHX6 polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant LHX6.
Gene id:	26468
Gene name:	LHX6
Gene alias:	LHX6.1\|MGC119542\|MGC119544\|MGC119545
Gene description:	LIM homeobox 6
Genbank accession:	NM_014368
Immunogen:	LHX6 (NP_055183, 274 a.a. ~ 363 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	HKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY
Protein accession:	NP_055183
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (36.01 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice