| Brand: | Abnova |
| Reference: | H00026354-Q01 |
| Product name: | GNL3 (Human) Recombinant Protein (Q01) |
| Product description: | Human GNL3 partial ORF ( AAH01024.1, 328 a.a. - 427 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 26354 |
| Gene name: | GNL3 |
| Gene alias: | C77032|E2IG3|MGC800|NS |
| Gene description: | guanine nucleotide binding protein-like 3 (nucleolar) |
| Genbank accession: | BC001024 |
| Immunogen sequence/protein sequence: | IEVVKPMEAASAILSQADARQVVLKYTVPGYRNSLEFFTMLAQRRGMHQKGGIPNVEGAAKLLWSEWTGASLAYYCHPPTSWTPPPYFNESIVVDMKSGF |
| Protein accession: | AAH01024.1 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |