| Brand: | Abnova |
| Reference: | H00026354-M10 |
| Product name: | GNL3 monoclonal antibody (M10), clone 2B9 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant GNL3. |
| Clone: | 2B9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 26354 |
| Gene name: | GNL3 |
| Gene alias: | C77032|E2IG3|MGC800|NS |
| Gene description: | guanine nucleotide binding protein-like 3 (nucleolar) |
| Genbank accession: | BC001024 |
| Immunogen: | GNL3 (AAH01024.1, 328 a.a. ~ 427 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | IEVVKPMEAASAILSQADARQVVLKYTVPGYRNSLEFFTMLAQRRGMHQKGGIPNVEGAAKLLWSEWTGASLAYYCHPPTSWTPPPYFNESIVVDMKSGF |
| Protein accession: | AAH01024.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged GNL3 is 0.1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |