No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00026354-M09 |
Product name: | GNL3 monoclonal antibody (M09), clone 4B10 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant GNL3. |
Clone: | 4B10 |
Isotype: | IgG2a Kappa |
Gene id: | 26354 |
Gene name: | GNL3 |
Gene alias: | C77032|E2IG3|MGC800|NS |
Gene description: | guanine nucleotide binding protein-like 3 (nucleolar) |
Genbank accession: | BC001024 |
Immunogen: | GNL3 (AAH01024.1, 328 a.a. ~ 427 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | IEVVKPMEAASAILSQADARQVVLKYTVPGYRNSLEFFTMLAQRRGMHQKGGIPNVEGAAKLLWSEWTGASLAYYCHPPTSWTPPPYFNESIVVDMKSGF |
Protein accession: | AAH01024.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged GNL3 is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |