No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00026353-M12 |
Product name: | HSPB8 monoclonal antibody (M12), clone 3C5 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant HSPB8. |
Clone: | 3C5 |
Isotype: | IgG1 Kappa |
Gene id: | 26353 |
Gene name: | HSPB8 |
Gene alias: | CMT2L|DHMN2|E2IG1|H11|HMN2|HMN2A|HSP22 |
Gene description: | heat shock 22kDa protein 8 |
Genbank accession: | BC002673 |
Immunogen: | HSPB8 (AAH02673.1, 1 a.a. ~ 196 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT |
Protein accession: | AAH02673.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (47.3 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | HSPB8 monoclonal antibody (M12), clone 3C5. Western Blot analysis of HSPB8 expression in HeLa(Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | NFκB is a central regulator of protein quality control in response to protein aggregation stresses via autophagy modulation.Nivon M, Fort L, Muller P, Richet E, Simon S, Guey B, Fournier M, Arrigo AP, Hetz C, Atkin JD, Kretz-Remy C. Mol Biol Cell. 2016 Apr 13. [Epub ahead of print] |