No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00026353-M02 |
Product name: | HSPB8 monoclonal antibody (M02), clone 5D7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HSPB8. |
Clone: | 5D7 |
Isotype: | IgG2b Kappa |
Gene id: | 26353 |
Gene name: | HSPB8 |
Gene alias: | CMT2L|DHMN2|E2IG1|H11|HMN2|HMN2A|HSP22 |
Gene description: | heat shock 22kDa protein 8 |
Genbank accession: | NM_014365 |
Immunogen: | HSPB8 (NP_055180, 97 a.a. ~ 196 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT |
Protein accession: | NP_055180 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of HSPB8 expression in transfected 293T cell line by HSPB8 monoclonal antibody (M02), clone 5D7. Lane 1: HSPB8 transfected lysate(35.446 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |