View larger

HSPB8 purified MaxPab mouse polyclonal antibody (B01P)

Reference:

Condition: New product

Data sheet of HSPB8 purified MaxPab mouse polyclonal antibody (B01P)

Brand:	Abnova
Reference:	H00026353-B01P
Product name:	HSPB8 purified MaxPab mouse polyclonal antibody (B01P)
Product description:	Mouse polyclonal antibody raised against a full-length human HSPB8 protein.
Gene id:	26353
Gene name:	HSPB8
Gene alias:	CMT2L\|DHMN2\|E2IG1\|H11\|HMN2\|HMN2A\|HSP22
Gene description:	heat shock 22kDa protein 8
Genbank accession:	NM_014365.2
Immunogen:	HSPB8 (NP_055180.1, 1 a.a. ~ 196 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT
Protein accession:	NP_055180.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of HSPB8 expression in transfected 293T cell line (H00026353-T02) by HSPB8 MaxPab polyclonal antibody. Lane 1: HSPB8 transfected lysate(21.56 KDa). Lane 2: Non-transfected lysate.
Applications:	WB-Ti,WB-Tr
Shipping condition:	Dry Ice