View larger

MYCBP MaxPab mouse polyclonal antibody (B01)

Reference:

Condition: New product

Data sheet of MYCBP MaxPab mouse polyclonal antibody (B01)

Brand:	Abnova
Reference:	H00026292-B01
Product name:	MYCBP MaxPab mouse polyclonal antibody (B01)
Product description:	Mouse polyclonal antibody raised against a full-length human MYCBP protein.
Gene id:	26292
Gene name:	MYCBP
Gene alias:	AMY-1
Gene description:	c-myc binding protein
Genbank accession:	BC008686
Immunogen:	MYCBP (AAH08686, 1 a.a. ~ 103 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE
Protein accession:	AAH08686
Storage buffer:	No additive
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Note:	For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of MYCBP expression in transfected 293T cell line (H00026292-T03) by MYCBP MaxPab polyclonal antibody. Lane 1: MYCBP transfected lysate(11.44 KDa). Lane 2: Non-transfected lysate.
Applications:	WB-Tr
Shipping condition:	Dry Ice