| Brand: | Abnova |
| Reference: | H00026291-M03 |
| Product name: | FGF21 monoclonal antibody (M03), clone 3G10 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant FGF21. |
| Clone: | 3G10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 26291 |
| Gene name: | FGF21 |
| Gene alias: | - |
| Gene description: | fibroblast growth factor 21 |
| Genbank accession: | BC018404 |
| Immunogen: | FGF21 (AAH18404, 30 a.a. ~ 209 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS |
| Protein accession: | AAH18404 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (45.54 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | FGF21 monoclonal antibody (M03), clone 3G10 Western Blot analysis of FGF21 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |