Brand: | Abnova |
Reference: | H00026270-D01P |
Product name: | FBXO6 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human FBXO6 protein. |
Gene id: | 26270 |
Gene name: | FBXO6 |
Gene alias: | FBG2|FBS2|FBX6|Fbx6b |
Gene description: | F-box protein 6 |
Genbank accession: | NM_018438.4 |
Immunogen: | FBXO6 (NP_060908.1, 1 a.a. ~ 293 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MDAPHSKAALDSINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLMTLWKRKCLREGFITKDWDQPVADWKIFYFLRSLHRNLLRNPCAEEDMFAWQIDFNGGDRWKVESLPGAHGTDFPDPKVKKYFVTSYEMCLKSQLVDLVAEGYWEELLDTFRPDIVVKDWFAARADCGCTYQLKVQLASADYFVLASFEPPPVTIQQWNNATWTEVSYTFSDYPRGVRYILFQHGGRDTQYWAGWYGPRVTNSSIVVSPKMTRNQASSEAQPGQKHGQEEAAQSPYRAVVQIF |
Protein accession: | NP_060908.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | FBXO6 MaxPab rabbit polyclonal antibody. Western Blot analysis of FBXO6 expression in human kidney. |
Applications: | WB-Ce,WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |