FBXO6 purified MaxPab rabbit polyclonal antibody (D01P) View larger

FBXO6 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FBXO6 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,WB-Ti,WB-Tr

More info about FBXO6 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00026270-D01P
Product name: FBXO6 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human FBXO6 protein.
Gene id: 26270
Gene name: FBXO6
Gene alias: FBG2|FBS2|FBX6|Fbx6b
Gene description: F-box protein 6
Genbank accession: NM_018438.4
Immunogen: FBXO6 (NP_060908.1, 1 a.a. ~ 293 a.a) full-length human protein.
Immunogen sequence/protein sequence: MDAPHSKAALDSINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLMTLWKRKCLREGFITKDWDQPVADWKIFYFLRSLHRNLLRNPCAEEDMFAWQIDFNGGDRWKVESLPGAHGTDFPDPKVKKYFVTSYEMCLKSQLVDLVAEGYWEELLDTFRPDIVVKDWFAARADCGCTYQLKVQLASADYFVLASFEPPPVTIQQWNNATWTEVSYTFSDYPRGVRYILFQHGGRDTQYWAGWYGPRVTNSSIVVSPKMTRNQASSEAQPGQKHGQEEAAQSPYRAVVQIF
Protein accession: NP_060908.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00026270-D01P-2-A0-1.jpg
Application image note: FBXO6 MaxPab rabbit polyclonal antibody. Western Blot analysis of FBXO6 expression in human kidney.
Applications: WB-Ce,WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FBXO6 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart