Brand: | Abnova |
Reference: | H00026267-A01 |
Product name: | FBXO10 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant FBXO10. |
Gene id: | 26267 |
Gene name: | FBXO10 |
Gene alias: | FBX10|FLJ41992|MGC149840 |
Gene description: | F-box protein 10 |
Genbank accession: | XM_291314 |
Immunogen: | FBXO10 (XP_291314, 863 a.a. ~ 962 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | RAKALVQENIIFQGKTSKTIFQQISNNRECIMQNNKFLVFKKKSDTWRLVNPPARPHLENSLRRPSAAHNGQKVTAMATRITARVEGGYHSNRSVFCTIL |
Protein accession: | XP_291314 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |