| Brand: | Abnova |
| Reference: | H00026263-M01 |
| Product name: | FBXO22 monoclonal antibody (M01), clone 6G9 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant FBXO22. |
| Clone: | 6G9 |
| Isotype: | IgG1 Kappa |
| Gene id: | 26263 |
| Gene name: | FBXO22 |
| Gene alias: | FBX22|FISTC1|FLJ13986|MGC31799 |
| Gene description: | F-box protein 22 |
| Genbank accession: | BC039024 |
| Immunogen: | FBXO22 (AAH39024, 1 a.a. ~ 299 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MADSETFISLEECRGHKRARKRTSMETALALEKLFPKQCQVLGIVTPGIVVTPMGSGSNRPQEIEIGESGFALLFPQIEGIKIQPFHFIKDPKNLTLERHQLTEVGLLDNPELRVVLVFGYNCCKVGASNYLQQVVSTFSDMNIILAGGQVDNLSSLTSEKNPLDIDASGVVGLSFSGHRIQSATVLLNEDVSDEKTAEAAMQRLKAANIPEHNTIGFMFACVGRGFQYYRAKGNVEADAFRKFFPSVPLFGFFGNGEIGCDRIVTGNFILRKCNEVKDDDLFHSYTTIMALIHLGSSK |
| Protein accession: | AAH39024 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (58.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | FBXO22 monoclonal antibody (M01), clone 6G9 Western Blot analysis of FBXO22 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |