NKX2-8 MaxPab mouse polyclonal antibody (B01) View larger

NKX2-8 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NKX2-8 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about NKX2-8 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00026257-B01
Product name: NKX2-8 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human NKX2-8 protein.
Gene id: 26257
Gene name: NKX2-8
Gene alias: NKX2.8|NKX2H|Nkx2-9
Gene description: NK2 homeobox 8
Genbank accession: NM_014360.2
Immunogen: NKX2-8 (NP_055175.2, 1 a.a. ~ 239 a.a) full-length human protein.
Immunogen sequence/protein sequence: MATSGRLSFTVRSLLDLPEQDAQHLPRREPEPRAPQPDPCAAWLDSERGHYPSSDESSLETSPPDSSQRPSARPASPGSDAEKRKKRRVLFSKAQTLELERRFRQQRYLSAPEREQLASLLRLTPTQVKIWFQNHRYKLKRARAPGAAESPDLAASAELHAAPGLLRRVVVPVLVRDGQPCGGGGGGEVGTAAAQEKCGAPPAAACPLPGYPAFGPGSALGLFPAYQHLASPALVSWNW
Protein accession: NP_055175.2
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026257-B01-13-15-1.jpg
Application image note: Western Blot analysis of NKX2-8 expression in transfected 293T cell line (H00026257-T01) by NKX2-8 MaxPab polyclonal antibody.

Lane 1: NKX2-8 transfected lysate(26.29 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NKX2-8 MaxPab mouse polyclonal antibody (B01) now

Add to cart