Cart 28 Product Products 10 456,90 € (empty)
No products
265,00 € DAP Shipping
10 721,90 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 28 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 10 456,90 €
Total shipping (tax excl.) 265,00 €
Total (tax excl.) 10 721,90 €
Data sheet of CABYR purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,WB-Tr |
More info about CABYR purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00026256-B01P |
| Product name: | CABYR purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human CABYR protein. |
| Gene id: | 26256 |
| Gene name: | CABYR |
| Gene alias: | CBP86|FSP-2|FSP2|MGC9117 |
| Gene description: | calcium binding tyrosine-(Y)-phosphorylation regulated |
| Genbank accession: | NM_138644.1 |
| Immunogen: | CABYR (NP_619585.1, 1 a.a. ~ 379 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MISSKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMDIKDLVKQFHQIKVEKWSEGTTPQKKLECLKEPGKTSVESKVPTQMEKSTDTDEDNVTRTEYSDKTTQFPSVYAVPGTEQTEAVGGLSSKPATPKTTTPPSSPPPTAVSPEFAYVPADPAQLAAQMLAMATSERGQPPPCSNMWTLYCLTDKNQQGHPSPPPAPGPFPQATLYLPNPKDPQFQQHPPKVTFPTYVMGDTKKTSAPPFILVGSNVQEAQGWKPLPGHAVVSQSDVLRYVAMQVPIAVPADEKYQKHTLSPQNANPPSGQDVPRPKSPVFLSVAFPVEDVAKKSSGSGDKCAPFGSYGIAGEVTVTTAHKRRKAETEN |
| Protein accession: | NP_619585.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CABYR expression in transfected 293T cell line (H00026256-T02) by CABYR MaxPab polyclonal antibody. Lane 1: CABYR transfected lysate(41.10 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |