Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CLEC4E monoclonal antibody (M08), clone 2D12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about CLEC4E monoclonal antibody (M08), clone 2D12
| Brand: | Abnova |
| Reference: | H00026253-M08 |
| Product name: | CLEC4E monoclonal antibody (M08), clone 2D12 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant CLEC4E. |
| Clone: | 2D12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 26253 |
| Gene name: | CLEC4E |
| Gene alias: | CLECSF9|MINCLE |
| Gene description: | C-type lectin domain family 4, member E |
| Genbank accession: | BC000715 |
| Immunogen: | CLEC4E (AAH00715, 1 a.a. ~ 219 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MNSSKSSETQCTERGCFSSQMFLWTVAGIPILFLSACFITRCVVTFRIFQTCDEKKFQLPENFTELSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMVGINPLNKGKSL |
| Protein accession: | AAH00715 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (49.83 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | http://www.abnova.com/application_image/ |
| Application image note: | Detection limit for recombinant GST tagged CLEC4E is approximately 3ng/ml as a capture antibody. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Mincle and human B cell function.Kawata K, Illarionov P, Kenny TP, Zhang W, Tsuda M, Ando Y, Leung PS, Ansari AA, Eric Gershwin M. J Autoimmun. 2012 Jun 12. |