Brand: | Abnova |
Reference: | H00026234-A01 |
Product name: | FBXL5 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant FBXL5. |
Gene id: | 26234 |
Gene name: | FBXL5 |
Gene alias: | FBL4|FBL5|FLR1 |
Gene description: | F-box and leucine-rich repeat protein 5 |
Genbank accession: | NM_012161 |
Immunogen: | FBXL5 (NP_036293, 584 a.a. ~ 691 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | LIYFGSEKSDQETGRVLLFLSLSGCYQITDHGLRVLTLGGGLPYLEHLNLSGCLTITGAGLQDLVSACPSLNDEYFYYCDNINGPHADTASGCQNLQCGFRACCRSGE |
Protein accession: | NP_036293 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.99 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | FBXL5 polyclonal antibody (A01), Lot # 051123JCS1 Western Blot analysis of FBXL5 expression in HepG2 ( Cat # L019V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |