| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Tr |
| Brand: | Abnova |
| Reference: | H00026232-M01 |
| Product name: | FBXO2 monoclonal antibody (M01), clone 1G4 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant FBXO2. |
| Clone: | 1G4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 26232 |
| Gene name: | FBXO2 |
| Gene alias: | FBG1|FBX2|Fbs1|NFB42 |
| Gene description: | F-box protein 2 |
| Genbank accession: | BC025233 |
| Immunogen: | FBXO2 (AAH25233, 1 a.a. ~ 296 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MDGDGDPESVGQPEEASPEEQPEEASAEEERPEDQQEEEAAAAAAYLDELPEPLLLRVLAALPAAELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEGGVEEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWCDVEHGGDGWRVEELPGDSGVEFTHDESVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRSDAGCLYELTVKLLSEHENVLAEFSSGQVAVPQDSDGGGWMEISHTFTDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP |
| Protein accession: | AAH25233 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of FBXO2 expression in transfected 293T cell line by FBXO2 monoclonal antibody (M01), clone 1G4. Lane 1: FBXO2 transfected lysate(33.3 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Tr |
| Shipping condition: | Dry Ice |