Cart 53 Product Products 15 903,22 € (empty)
-
-
1 x Olfactory...259,07 € -
-
-
-
-
-
-
-
-
1 x HoxD12...259,07 € -
1 x p53...259,07 € -
1 x Op18...259,07 € -
-
-
1 x TCR β...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Olfactory...259,07 € -
1 x Olfactory...259,07 € -
1 x Phospho-GA...259,07 € -
1 x PERK...259,07 € -
-
-
-
-
No products
To be determined Shipping
15 903,22 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 53 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 15 903,22 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 15 903,22 €
Data sheet of BRDG1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about BRDG1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00026228-A01 |
| Product name: | BRDG1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant BRDG1. |
| Gene id: | 26228 |
| Gene name: | STAP1 |
| Gene alias: | BRDG1|STAP-1 |
| Gene description: | signal transducing adaptor family member 1 |
| Genbank accession: | NM_012108 |
| Immunogen: | BRDG1 (NP_036240, 186 a.a. ~ 293 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | EATEMLQKNPSLGNMILRPGSDSRNYSITIRQEIDIPRIKHYKVMSVGQNYTIELEKPVTLPNLFSVIDYFVKETRGNLRPFICSTDENTGQEPSMEGRSEKLKKNPH |
| Protein accession: | NP_036240 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |