No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,WB-Ti,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Brand: | Abnova |
Reference: | H00026227-M01 |
Product name: | PHGDH monoclonal antibody (M01), clone 4A3-1D6 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant PHGDH. |
Clone: | 4A3-1D6 |
Isotype: | IgG1 kappa |
Gene id: | 26227 |
Gene name: | PHGDH |
Gene alias: | 3-PGDH|3PGDH|MGC3017|PDG|PGAD|PGD|PGDH|SERA |
Gene description: | phosphoglycerate dehydrogenase |
Genbank accession: | BC011262 |
Immunogen: | PHGDH (AAH11262.1, 1 a.a. ~ 533 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLVSDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF |
Protein accession: | AAH11262.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (84.37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | PHGDH monoclonal antibody (M01), clone 4A3-1D6. Western Blot analysis of PHGDH expression in human liver. |
Applications: | WB-Ce,WB-Ti,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |
Publications: | Enhanced serine production by bone metastatic breast cancer cells stimulates osteoclastogenesis.Pollari S, Kakonen SM, Edgren H, Wolf M, Kohonen P, Sara H, Guise T, Nees M, Kallioniemi O. Breast Cancer Res Treat. 2010 Mar 30. [Epub ahead of print] |