| Brand: | Abnova |
| Reference: | H00026226-M15 |
| Product name: | SHFM3P1 monoclonal antibody (M15), clone 2C5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SHFM3P1. |
| Clone: | 2C5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 26226 |
| Gene name: | FBXW4P1 |
| Gene alias: | FBW3|FBXW3|SHFM3P1 |
| Gene description: | F-box and WD repeat domain containing 4 pseudogene 1 |
| Genbank accession: | AF174606 |
| Immunogen: | SHFM3P1 (AAF04527, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EVLLLHMCSYLDMRALGRLAQVYRWLWHFTNCDLLRRQIAWASLNSGFTRLGTNLMTSVPVKVSQNWIVGCCREGILLKWRCSQMPWMQLEDDALYISQA |
| Protein accession: | AAF04527 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged FBXW4P1 is 3 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |