Cart 13 Product Products 3 719,42 € (empty)
No products
To be determined Shipping
3 719,42 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 13 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 3 719,42 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 3 719,42 €
Data sheet of ARL5A purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about ARL5A purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00026225-B01P |
| Product name: | ARL5A purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human ARL5A protein. |
| Gene id: | 26225 |
| Gene name: | ARL5A |
| Gene alias: | ARFLP5|ARL5 |
| Gene description: | ADP-ribosylation factor-like 5A |
| Genbank accession: | NM_012097 |
| Immunogen: | ARL5A (NP_036229.1, 1 a.a. ~ 179 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLKIR |
| Protein accession: | NP_036229.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of ARL5A expression in transfected 293T cell line (H00026225-T01) by ARL5A MaxPab polyclonal antibody. Lane 1: ARL5A transfected lysate(19.69 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |