| Brand: | Abnova |
| Reference: | H00026191-M01 |
| Product name: | PTPN22 monoclonal antibody (M01), clone 4F6 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant PTPN22. |
| Clone: | 4F6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 26191 |
| Gene name: | PTPN22 |
| Gene alias: | LYP|Lyp1|Lyp2|PEP|PTPN8 |
| Gene description: | protein tyrosine phosphatase, non-receptor type 22 (lymphoid) |
| Genbank accession: | BC017785 |
| Immunogen: | PTPN22 (AAH17785, 1 a.a. ~ 179 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEYSVLIIVMACMEYEMGKEAEKRKSDYIIRTLKVKFNSVSVILAHQTSLQNLFSQITPAHF |
| Protein accession: | AAH17785 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (45.43 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western blot analysis of PTPN22 over-expressed 293 cell line, cotransfected with PTPN22 Validated Chimera RNAi ( Cat # H00026191-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PTPN22 monoclonal antibody (M01), clone 4F6 (Cat # H00026191-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | Experimental ischemia/reperfusion model impairs endocannabinoid signaling and Na+/K+ ATPase expression and activity in kidney proximal tubule cells.Sampaio LS, Iannotti FA, Veneziani L, Borelli-Torres RT, De Maio F, Piscitelli F, Reis RAM, Di Marzo V, Einicker-Lamas M. Biochem Pharmacol. 2018 Aug;154:482-491. doi: 10.1016/j.bcp.2018.06.005. Epub 2018 Jun 8. |