No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Brand: | Abnova |
Reference: | H00026191-M01 |
Product name: | PTPN22 monoclonal antibody (M01), clone 4F6 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant PTPN22. |
Clone: | 4F6 |
Isotype: | IgG2a Kappa |
Gene id: | 26191 |
Gene name: | PTPN22 |
Gene alias: | LYP|Lyp1|Lyp2|PEP|PTPN8 |
Gene description: | protein tyrosine phosphatase, non-receptor type 22 (lymphoid) |
Genbank accession: | BC017785 |
Immunogen: | PTPN22 (AAH17785, 1 a.a. ~ 179 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEYSVLIIVMACMEYEMGKEAEKRKSDYIIRTLKVKFNSVSVILAHQTSLQNLFSQITPAHF |
Protein accession: | AAH17785 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (45.43 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western blot analysis of PTPN22 over-expressed 293 cell line, cotransfected with PTPN22 Validated Chimera RNAi ( Cat # H00026191-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PTPN22 monoclonal antibody (M01), clone 4F6 (Cat # H00026191-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |
Publications: | Experimental ischemia/reperfusion model impairs endocannabinoid signaling and Na+/K+ ATPase expression and activity in kidney proximal tubule cells.Sampaio LS, Iannotti FA, Veneziani L, Borelli-Torres RT, De Maio F, Piscitelli F, Reis RAM, Di Marzo V, Einicker-Lamas M. Biochem Pharmacol. 2018 Aug;154:482-491. doi: 10.1016/j.bcp.2018.06.005. Epub 2018 Jun 8. |