Cart 174 Product Products 51 364,37 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Phospho-CR...259,07 € -
-
-
-
1 x FoxE3...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x JMJD2B...259,07 € -
1 x NARF...259,07 € -
1 x ZO-2...259,07 € -
-
-
-
-
-
-
-
-
-
1 x CD272...259,07 € -
1 x PPAR-α...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Septin 2...259,07 € -
-
-
1 x Rad51...259,07 € -
1 x OAT1...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Dynactin 2...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Kpm...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
1 x Rad54B...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
51 364,37 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 174 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 51 364,37 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 51 364,37 €
Data sheet of NAT9 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,WB-Tr |
More info about NAT9 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00026151-B01P |
| Product name: | NAT9 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human NAT9 protein. |
| Gene id: | 26151 |
| Gene name: | NAT9 |
| Gene alias: | DKFZp564C103|EBSP |
| Gene description: | N-acetyltransferase 9 (GCN5-related, putative) |
| Genbank accession: | NM_015654 |
| Immunogen: | NAT9 (NP_056469.2, 1 a.a. ~ 207 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQEYAMQCSWQEDADKCTFIVLDAEKWQAQPGATEESCMVGDVNLFLTDLEDLTLGEIEVMIAEPSCRGKGLGTEAVLAMLSYGVTTLGLTKFEAKIGQGNEPSIRMFQKLHFEQVATSSVFQEVTLRLTVSESEHQWLLEQTSHVEEKPYRDGSAEPC |
| Protein accession: | NP_056469.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of NAT9 expression in transfected 293T cell line by NAT9 MaxPab polyclonal antibody. Lane 1: NAT9 transfected lysate(22.77 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |