| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,WB-Tr |
| Brand: | Abnova |
| Reference: | H00026140-B02 |
| Product name: | TTLL3 MaxPab mouse polyclonal antibody (B02) |
| Product description: | Mouse polyclonal antibody raised against a full-length human TTLL3 protein. |
| Gene id: | 26140 |
| Gene name: | TTLL3 |
| Gene alias: | DKFZp434B103|DKFZp686D076|FLJ13898|HOTTL|MGC120529|MGC120530|MGC120532 |
| Gene description: | tubulin tyrosine ligase-like family, member 3 |
| Genbank accession: | BC009479 |
| Immunogen: | TTLL3 (AAH09479, 1 a.a. ~ 101 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | TEGDRNIWIVKPGAKSRGRGIMCMDHLEEMLKLVNGNPVVMKDGKWVVQKYIERPLLIFGTKFDLRQWFLVTDWNPLTVWFYRDSYIRFSTQPFSLKNLDK |
| Protein accession: | AAH09479 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of TTLL3 expression in transfected 293T cell line (H00026140-T03) by TTLL3 MaxPab polyclonal antibody. Lane 1: TTLL3 transfected lysate(11.22 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |